PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009143406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 292aa    MW: 34855.1 Da    PI: 6.806
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009143406.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.11.6e-2539121186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++Li++r e+++++ ++k++k lWe vs+kmr++ f rsp+qCk+kw+nl +r+k +++++++    +++++p++d+++
  XP_009143406.1  39 QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTRFKGCETMDEEI---ARQQFPFYDDMQ 121
                     7********************************************************************97...45679*****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00183698IPR001005SANT/Myb domain
CDDcd122033.44E-2238103No hitNo description
PfamPF138373.4E-1939121No hitNo description
PROSITE profilePS500907.5384096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDQHQLHQLH YLNKHHHQLH PQSQTPELAS PATGDRFPQW SLEETKELIA IRGELDQTFM  60
ETKRNKLLWE VVSNKMRDKS FLRSPEQCKC KWKNLVTRFK GCETMDEEIA RQQFPFYDDM  120
QIIFASRMQR MLWAESEGGG GTSGATRKRS HSEQFSSDEE EENVNEELVG ISNESKTLNP  180
EKNIAKKRKG GISNSSGGAN NNVREVLDEF MRHQMRMENE WRERWEAREK ERAEKEEEWR  240
RKMEELEKER MAMERMWRDR EEQRRSREEL RAEKRDSLIN TLLAKLTRDG SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1336117384DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143406.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-121TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLM4CLP00.0M4CLP0_BRARP; Uncharacterized protein
STRINGBra005127.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.16e-93Trihelix family protein